Erratum: Adhesive L1CAM-Robo Signaling Aligns Growth Cone F-Actin Dynamics to Promote Axon-Dendrite Fasciculation in C. elegans (Developmental Cell (2019) 48(2) (215–228.e5), (S1534580718309171), (10.1016/j.devcel.2018.10.028))

Chen, Chun-HaoChun-HaoChenHsu, Hao-WeiHao-WeiHsuChang, Yun-HsuanYun-HsuanChangCHUN-LIANG PAN2024-03-272024-03-272019-05-0615345807https://scholars.lib.ntu.edu.tw/handle/123456789/641497(Developmental Cell 48, 215–228.e1–e5; January 28, 2019) In the originally published version of this paper, the authors inadvertently introduced an error in the wild-type (N2) SAX-7S protein sequence shown in Figure S3A. The correct wild-type SAX-7S sequence should be “1MGLRETMGRGGPPNTTTFIFLLGCLLFLVSDRYYTCTAENIELKDYKFGNQFS53.” This error has been corrected here and in the revised Supplemental Information PDF online. None of the conclusions of the paper are affected by this error. The authors apologize for any inconvenience this error may have caused, and they thank Dylan Rahe for bringing this issue to their attention. [figure-presented]enErratum: Adhesive L1CAM-Robo Signaling Aligns Growth Cone F-Actin Dynamics to Promote Axon-Dendrite Fasciculation in C. elegans (Developmental Cell (2019) 48(2) (215–228.e5), (S1534580718309171), (10.1016/j.devcel.2018.10.028))corrigendum10.1016/j.devcel.2019.04.028310637612-s2.0-85064659609https://api.elsevier.com/content/abstract/scopus_id/85064659609